PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02676.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 310aa    MW: 33709.1 Da    PI: 7.0395
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02676.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT+eEd +lv +v+++G+g+W++++   g+ R+ k+c++rw +yl
  Zmw_sc02676.1.g00020.1.sm.mk 14 KGPWTPEEDIILVSYVQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYL 61
                                  79********************************************97 PP

2Myb_DNA-binding47.54e-1567112148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg++T+ E+ ++v++  +lG++ W++Ia++++  Rt++++k++w+++l
  Zmw_sc02676.1.g00020.1.sm.mk  67 RGNFTPHEEGIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                                   89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129425.638965IPR017930Myb domain
SuperFamilySSF466891.46E-3011108IPR009057Homeodomain-like
SMARTSM007172.5E-131363IPR001005SANT/Myb domain
PfamPF002493.0E-161461IPR001005SANT/Myb domain
CDDcd001675.31E-121661No hitNo description
Gene3DG3DSA:1.10.10.606.4E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129418.7466116IPR017930Myb domain
SMARTSM007175.4E-1366114IPR001005SANT/Myb domain
PfamPF002495.4E-1367112IPR001005SANT/Myb domain
CDDcd001675.32E-969110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYVQ EHGPGNWRSV PINTGLMRCS KSCRLRWTNY  60
LRPGIRRGNF TPHEEGIIVH LQSLLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKHQ  120
AIGAIFAPPP SDLSSSTVPT LTGAGHGGHP VITSPLSKDN YAPHTACSNP GDDVTQLISR  180
RSPFAAAGSL DAESSSSSSY ASSMDNISKL LDGFMKSTTP QNDAADIKPS SNPLLSFEQG  240
SGGSALPNFA DVLLPQPVLM EERSHHEQPK QQQEQAPLSS IEKWLLDEAA EQVGGLMDLS  300
DGCCSVPMLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-25141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C5e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978476.11e-140PREDICTED: transcription factor MYB30-like
SwissprotQ9SCU72e-85MYB30_ARATH; Transcription factor MYB30
TrEMBLL0P1U91e-147L0P1U9_9POAL; PH01B001E05.10 protein
STRINGSi026651m1e-139(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296